Author: bugman Date: Mon Feb 16 11:34:05 2009 New Revision: 8806 URL: http://svn.gna.org/viewcvs/relax?rev=8806&view=rev Log: The RDC data is now formatted for Pales, to check the synthetic test model and relax. Added: 1.3/test_suite/shared_data/align_data/CaM/pales.in Modified: 1.3/test_suite/shared_data/align_data/CaM/generate_data.py Modified: 1.3/test_suite/shared_data/align_data/CaM/generate_data.py URL: http://svn.gna.org/viewcvs/relax/1.3/test_suite/shared_data/align_data/CaM/generate_data.py?rev=8806&r1=8805&r2=8806&view=diff ============================================================================== --- 1.3/test_suite/shared_data/align_data/CaM/generate_data.py (original) +++ 1.3/test_suite/shared_data/align_data/CaM/generate_data.py Mon Feb 16 11:34:05 2009 @@ -80,6 +80,16 @@ rdc_file = open('synth_rdc', 'w') pcs_file = open('synth_pcs', 'w') +# Open the Pales input file. +pales_file = open('pales.in', 'w') + +# The Pales header. +pales_file.write("DATA SEQUENCE ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT\n") +pales_file.write("DATA SEQUENCE MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEE\n") +pales_file.write("DATA SEQUENCE FVQMMTAK\n\n") +pales_file.write("VARS RESID_I RESNAME_I ATOMNAME_I RESID_J RESNAME_J ATOMNAME_J D DD W\n") +pales_file.write("FORMAT %5d %6s %6s %5d %6s %6s %9.3f %9.3f %.2f\n\n") + # Loop over the N spins. for spin, mol, res_num, res_name in spin_loop(full_info=True): # Skip deselected spins. @@ -116,6 +126,9 @@ rdc = dip_const * dot(transpose(spin.xh_vect), dot(tensor, spin.xh_vect)) rdc_file.write("%20s%10s%10s%10s%10s%30.11f\n" % (mol, res_num, res_name, spin.num, spin.name, rdc)) + # The Pales data line (equal weight, no errors). + pales_file.write("%5d %6s %6s %5d %6s %6s %9.3f %9.3f %.2f\n" % (res_num, res_name, spin.name, res_num, res_name, spin.attached_atom, rdc, 0.0, 1.0)) + # Print outs. print "\nAlignment tensor (A):\n" + `tensor` print "Eigenvalues: " + `eigvals(tensor)` Added: 1.3/test_suite/shared_data/align_data/CaM/pales.in URL: http://svn.gna.org/viewcvs/relax/1.3/test_suite/shared_data/align_data/CaM/pales.in?rev=8806&view=auto ============================================================================== --- 1.3/test_suite/shared_data/align_data/CaM/pales.in (added) +++ 1.3/test_suite/shared_data/align_data/CaM/pales.in Mon Feb 16 11:34:05 2009 @@ -1,0 +1,36 @@ +DATA SEQUENCE ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT +DATA SEQUENCE MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEE +DATA SEQUENCE FVQMMTAK + +VARS RESID_I RESNAME_I ATOMNAME_I RESID_J RESNAME_J ATOMNAME_J D DD W +FORMAT %5d %6s %6s %5d %6s %6s %9.3f %9.3f %.2f + + 83 GLU N 83 GLU H 5.949 0.000 1.00 + 84 GLU N 84 GLU H 14.153 0.000 1.00 + 85 ILE N 85 ILE H 7.482 0.000 1.00 + 111 ASN N 111 ASN H -3.607 0.000 1.00 + 112 LEU N 112 LEU H -2.223 0.000 1.00 + 113 GLY N 113 GLY H 12.165 0.000 1.00 + 114 GLU N 114 GLU H -9.635 0.000 1.00 + 115 LYS N 115 LYS H 2.484 0.000 1.00 + 116 LEU N 116 LEU H -6.181 0.000 1.00 + 117 THR N 117 THR H 13.928 0.000 1.00 + 118 ASP N 118 ASP H 2.688 0.000 1.00 + 119 GLU N 119 GLU H -5.002 0.000 1.00 + 120 GLU N 120 GLU H 4.337 0.000 1.00 + 121 VAL N 121 VAL H 6.676 0.000 1.00 + 122 ASP N 122 ASP H -4.988 0.000 1.00 + 123 GLU N 123 GLU H -2.490 0.000 1.00 + 124 MET N 124 MET H 4.141 0.000 1.00 + 126 ARG N 126 ARG H -5.862 0.000 1.00 + 127 GLU N 127 GLU H 0.767 0.000 1.00 + 128 ALA N 128 ALA H 4.056 0.000 1.00 + 130 ILE N 130 ILE H -11.570 0.000 1.00 + 131 ASP N 131 ASP H -1.766 0.000 1.00 + 132 GLY N 132 GLY H 4.570 0.000 1.00 + 143 GLN N 143 GLN H 4.751 0.000 1.00 + 144 MET N 144 MET H 7.439 0.000 1.00 + 145 MET N 145 MET H -2.422 0.000 1.00 + 146 THR N 146 THR H 3.873 0.000 1.00 + 147 ALA N 147 ALA H 7.271 0.000 1.00 + 148 LYS N 148 LYS H -3.397 0.000 1.00