Author: bugman Date: Thu Jan 29 16:20:54 2015 New Revision: 27360 URL: http://svn.gna.org/viewcvs/relax?rev=27360&view=rev Log: Deleted the Test_coordinates.test_common_residues unit test. This is from the _lib._structure._internal.test_coordinates unit test module. The lib.structure.internal.coordinates.common_residues() function no longer exists. Modified: trunk/test_suite/unit_tests/_lib/_structure/_internal/test_coordinates.py Modified: trunk/test_suite/unit_tests/_lib/_structure/_internal/test_coordinates.py URL: http://svn.gna.org/viewcvs/relax/trunk/test_suite/unit_tests/_lib/_structure/_internal/test_coordinates.py?rev=27360&r1=27359&r2=27360&view=diff ============================================================================== --- trunk/test_suite/unit_tests/_lib/_structure/_internal/test_coordinates.py (original) +++ trunk/test_suite/unit_tests/_lib/_structure/_internal/test_coordinates.py Thu Jan 29 16:20:54 2015 @@ -29,46 +29,3 @@ class Test_coordinates(UnitTestCase): """Unit tests for the functions of the 'lib.structure.internal.coordinates' module.""" - - def test_common_residues(self): - """Test the lib.structure.internal.coordinates.common_residues() function.""" - - # The gap matrices. - gap_matrices = [ - array([ - [1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1], - [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0] - ], int16), - array([ - [1, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1], - [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0] - ], int16) - ] - seq1 = 'TEEQVDADGGT' - seq2 = 'ADQLTEEQVDADGNGTIDFPEFLTMMARKM' - seq3 = 'LTEEQMINEVDAGNGTIDFPEFLTMMAR' - - # Determine the common residues. - skip, gapped_strings = coordinates.common_residues(gap_matrices=gap_matrices, one_letter_codes=[seq1, seq2, seq3], seq=True) - - # The expected skipping matrices. - N = len(seq1) - skip_real = [ - [0]*4 + [1]*4 + [0]*(N-8), - [1]*4 + [0]*N + [1]*(len(seq2)-N-4), - [1] + [0]*N + [1]*(len(seq3)-N-1) - ] - - # The expected gapped strings. - gapped_seq1 = '----TEEQ----VDA-G-GT----------------' - gapped_seq2 = '----TEEQ----VDA-G-GT----------------' - gapped_seq3 = '----TEEQMINEVDA-G-GT----------------' - gapped_real = [gapped_seq1, gapped_seq2, gapped_seq3] - - # Checks. - for i in range(3): - print("Sequence %i" % (i+1)) - self.assertEqual(len(skip_real[i]), len(skip[i])) - for j in range(len(skip_real[i])): - self.assertEqual(skip_real[i][j], skip[i][j]) - #self.assertEqual(gapped_real[i], gapped_strings[i])