Author: bugman Date: Sat Jan 31 17:26:57 2015 New Revision: 27430 URL: http://svn.gna.org/viewcvs/relax?rev=27430&view=rev Log: Corrections and simplifications for the Structure.test_sequence_alignment_residue_number system test. Modified: trunk/test_suite/system_tests/structure.py Modified: trunk/test_suite/system_tests/structure.py URL: http://svn.gna.org/viewcvs/relax/trunk/test_suite/system_tests/structure.py?rev=27430&r1=27429&r2=27430&view=diff ============================================================================== --- trunk/test_suite/system_tests/structure.py (original) +++ trunk/test_suite/system_tests/structure.py Sat Jan 31 17:26:57 2015 @@ -4732,6 +4732,7 @@ # Delete some residues. self.interpreter.structure.delete("#CaM B:82") self.interpreter.structure.delete("#CaM A:100-120") + self.interpreter.structure.delete(":CA") # Perform the alignment. self.interpreter.structure.sequence_alignment(pipes=['mf'], models=[[1, 1]], molecules=[['CaM A', 'CaM B']], msa_algorithm='residue number') @@ -4752,12 +4753,12 @@ molecules = ['CaM A', 'CaM B'] ids = ["Object 'mf'; Model 1; Molecule 'CaM A'", "Object 'mf'; Model 1; Molecule 'CaM B'"] sequences = [ - 'EEEIREAFRVFDKDGNGYVDEMIREADIDGDGQVNYEEFVQMMTAK**', - 'EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK**' + 'EEEIREAFRVFDKDGNGYVDEMIREADIDGDGQVNYEEFVQMMTAK', + 'EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK' ] strings = [ - 'EEEIREAFRVFDKDGNGY---------------------VDEMIREADIDGDGQVNYEEFVQMMTAK**', - '-EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK**' + 'EEEIREAFRVFDKDGNGY---------------------VDEMIREADIDGDGQVNYEEFVQMMTAK', + '-EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK' ] gaps = [] for i in range(len(strings)): @@ -4767,13 +4768,13 @@ for i in range(18, 39): gaps[0][i] = 1 gaps[1][0] = 1 - msa_algorithm = 'Central Star' - pairwise_algorithm = 'NW70' - matrix = 'BLOSUM62' - gap_open_penalty = 10.0 - gap_extend_penalty = 1.0 - end_gap_open_penalty = 0.5 - end_gap_extend_penalty = 0.1 + msa_algorithm = 'residue number' + pairwise_algorithm = None + matrix = None + gap_open_penalty = None + gap_extend_penalty = None + end_gap_open_penalty = None + end_gap_extend_penalty = None # Check the data. for i in range(2):