Author: bugman Date: Wed Jan 21 15:52:03 2015 New Revision: 27259 URL: http://svn.gna.org/viewcvs/relax?rev=27259&view=rev Log: Created a unit test for lib.sequence_alignment.align_protein.align_pairwise(). This is to test the pairwise alignment of two protein sequences using the Needleman-Wunsch sequence alignment algorithm, BLOSUM62 substitution matrix, and gap penalty of 10.0. Added: trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_align_protein.py - copied, changed from r27254, trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_needleman_wunsch.py Copied: trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_align_protein.py (from r27254, trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_needleman_wunsch.py) URL: http://svn.gna.org/viewcvs/relax/trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_align_protein.py?p2=trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_align_protein.py&p1=trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_needleman_wunsch.py&r1=27254&r2=27259&rev=27259&view=diff ============================================================================== --- trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_needleman_wunsch.py (original) +++ trunk/test_suite/unit_tests/_lib/_sequence_alignment/test_align_protein.py Wed Jan 21 15:52:03 2015 @@ -20,39 +20,62 @@ ############################################################################### # Python module imports. +from numpy import int16, zeros from unittest import TestCase # relax module imports. -from lib.sequence_alignment.needleman_wunsch import needleman_wunsch_align +from lib.sequence_alignment.align_protein import align_pairwise -class Test_needleman_wunsch(TestCase): - """Unit tests for the lib.sequence_alignment.needleman_wunsch relax module.""" +class Test_align_protein(TestCase): + """Unit tests for the lib.sequence_alignment.align_protein relax module.""" - def test_needleman_wunsch_align_DNA(self): - """Test the Needleman-Wunsch sequence alignment for two DNA sequences.""" + def test_align_pairwise(self): + """Test the Needleman-Wunsch sequence alignment for two protein sequences. + + This uses the sequences: + + - 'IHAAEEKDWKTAYSYbgFYEAFEGYdsidspkaitslkymllckimlntpedvqalvsgkla', + - 'LHAADEKDFKTAFSYabiggapFYEAFEGYdsvdekvsaltalkymllckvmldlpdevnsllsakl'. + + From online servers, the results should be:: + + https://www.ebi.ac.uk/Tools/psa/emboss_needle/ + EMBOSS_001 IHAAEEKDWKTAYSY-B-G---FYEAFEGYDSIDSP-KAITSLKYMLLCKIMLNTPEDVQALVSGKLA + :|||:|||:|||:|| | | ||||||||||:|.. .|:|:||||||||:||:.|::|.:|:|.|| + EMBOSS_001 LHAADEKDFKTAFSYABIGGAPFYEAFEGYDSVDEKVSALTALKYMLLCKVMLDLPDEVNSLLSAKL- + + http://web.expasy.org/cgi-bin/sim/sim.pl?prot + UserSeq1 IHAAEEKDWKTAYSY-B-G---FYEAFEGYDSIDSP-KAITSLKYMLLCKIMLNTPEDVQALVSGKL + UserSeq2 LHAADEKDFKTAFSYABIGGAPFYEAFEGYDSVDEKVSALTALKYMLLCKVMLDLPDEVNSLLSAKL + *** *** *** ** * * ********** * * * ******** ** * * * * ** + """ # The sequences. - seq1 = 'GCATGCU' - seq2 = 'GATTACA' + seq1 = 'IHAAEEKDWKTAYSYbgFYEAFEGYdsidspkaitslkymllckimlntpedvqalvsgkla' + seq2 = 'LHAADEKDFKTAFSYabiggapFYEAFEGYdsvdekvsaltalkymllckvmldlpdevnsllsakl' print(seq1) print(seq2) # Perform the alignment. - align1, align2, gaps = needleman_wunsch_align(seq1, seq2) + align1, align2, gaps = align_pairwise(seq1, seq2, matrix='BLOSUM62', gap_penalty=10.0) print(align1) print(align2) print(gaps) # Check the alignment. - self.assertEqual(align1, 'GCA-TGCU') - self.assertEqual(align2, 'G-ATTACA') + self.assertEqual(align1, 'IHAAEEKDWKTAYSY-B-G---FYEAFEGYDSIDSP-KAITSLKYMLLCKIMLNTPEDVQALVSGKLA') + self.assertEqual(align2, 'LHAADEKDFKTAFSYABIGGAPFYEAFEGYDSVDEKVSALTALKYMLLCKVMLDLPDEVNSLLSAKL-') # The gap matrix. - real_gaps = [ - [0, 0, 0, 1, 0, 0, 0, 0], - [0, 1, 0, 0, 0, 0, 0, 0] - ] + real_gaps = zeros((2, 68), int16) + real_gaps[0, 15] = 1 + real_gaps[0, 17] = 1 + real_gaps[0, 19] = 1 + real_gaps[0, 20] = 1 + real_gaps[0, 21] = 1 + real_gaps[0, 36] = 1 + real_gaps[1, 67] = 1 for i in range(2): - for j in range(8): + for j in range(68): self.assertEqual(gaps[i, j], real_gaps[i][j])